PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G015794.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family MYB
Protein Properties Length: 516aa    MW: 56882.2 Da    PI: 7.3067
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G015794.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.82.5e-18552148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  HL.SW.v1.0.G015794.1  5 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 52
                          678*******************************************97 PP

2Myb_DNA-binding44.73.1e-1458101146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           rg+++++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  HL.SW.v1.0.G015794.1  58 RGPFSQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 101
                           89********************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-25155IPR009057Homeodomain-like
PROSITE profilePS5129427.281156IPR017930Myb domain
SuperFamilySSF466896.74E-30399IPR009057Homeodomain-like
SMARTSM007172.2E-13454IPR001005SANT/Myb domain
PfamPF002494.1E-16552IPR001005SANT/Myb domain
CDDcd001674.02E-12852No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2556107IPR009057Homeodomain-like
PROSITE profilePS5129420.42157107IPR017930Myb domain
SMARTSM007171.2E-1257105IPR001005SANT/Myb domain
PfamPF002494.2E-1358101IPR001005SANT/Myb domain
CDDcd001672.17E-960100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 516 aa     Download sequence    Send to blast
QKLRKGLWSP EEDEKLLNYI TKHGHGCWSS VPKLAGLQRC GKSCRLRWIN YLRPDLKRGP  60
FSQQEENLII ELHAVLGNRW SQIAAQLPGR TDNEIKNLWN SCIKKKLRQK GIDPNTHKPL  120
SEVENDIGKL DKASSMTNKA GNNNNENNST VKASSLGTLS NDHHHHHHHH LNLAESQPSI  180
TIDRYPLLEV SSATPPTQEF FIEKSDVVSN TTSSCRPSDF ASYFSFHSNN YGTTSSSQDQ  240
NNNNSMASFC FNINQSSTTS TRPPPSSNSN NLSPVHHHHH HQQQQQHDHH HHHQMISSLI  300
PPPVSSCSIF SSSPSSTTSS SSPTNPRVKP SISLPLSDHQ NPSTVSCEVN NNNGVVVQNW  360
EASTFSNNGS SSSSCNIELQ SQGNNFFDNS NSTTAAAATA AAATTTVPPN AANFSWGLVP  420
ESGTIKSDDP EDIKWSEYLH SPFLLGAASN NQNSSQPILY SNIVKPESHF TTGSNSTWHQ  480
NEHNHHHHQL QAASSEIMYT NKDLQRLAVA FGQTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2731075108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007207615.11e-129hypothetical protein PRUPE_ppa019718mg
TrEMBLM5W5301e-129M5W530_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s00340.11e-125(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.14e-81myb domain protein 50